Hi everybody,
I am a student and so not really expert with PP. I have a .fasta file from DrugBank that in the description reports the DB codes of the compounds that target the relative protein sequence:
e.g.:
>drugbank_target|3 Histidine decarboxylase (DB00114; DB00117)
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAY[...]
In PP I can see the file in HTML as a table with a property called "Description" reporting name and DB codes (e.g. "Histidine decarboxylase (DB00114; DB00117)"), and a property called "Data" reporting just the sequence. Therefore, every sequence has different DB codes associated with it, and vice versa the DB codes will be related to different sequences. What I would like to do, if possible, is to obatin a table sorted by DrugBank code, so to have for each drug (i.e. DB code) the name of the protein and its sequence in other 2 columns.
Thanks for the help,
Matteo