Hi all,

I do BLAST with DS2.5.5. I've done this many times and got normal results. However, this time, I found part of my sequence become XXXXXXXX in the output. Anybody tell me why?

Part of my sequence is

DIVLTQPPSVSGAPGQRVTISCSGSSSNIGSNYVSWYQ    this is my query sequence in input

VLTQPPSVSGAPGQRVTXXXXXXXXXXXXXYVSWYQ         this is my query sequence in output

VLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQ       a result

Thanks in advance!!

Ming, Ph.D